PDB entry 1e0o

View 1e0o on RCSB PDB site
Description: crystal structure of a ternary fgf1-fgfr2-heparin complex
Deposited on 2000-04-03, released 2000-10-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-11, with a file datestamp of 2000-11-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.274
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0oA (A:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e0oB (B:)
    nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
    vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanast
    vvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievly
    irnvtfedageytclagnsigisfhsawltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0oB (B:)
    nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
    vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanast
    vvggdvefvckvysdaqphiqwikhlkvlkaagvnttdkeievlyirnvtfedageytcl
    agnsigisfhsawltvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0oC (C:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e0oD (D:)
    nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
    vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanast
    vvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievly
    irnvtfedageytclagnsigisfhsawltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0oD (D:)
    nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
    vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanast
    vvggdvefvckvysdaqphiqwikhkvlkaagvnttdkeievlyirnvtfedageytcla
    gnsigisfhsawltvl