PDB entry 1e0m

View 1e0m on RCSB PDB site
Description: PROTOTYPE WW domain
Class: de novo protein
Keywords: sh3 prototype, wwprototype, protein design, de novo protein
Deposited on 2000-04-01, released 2000-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: wwprototype
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 1E0M (0-36)
  Domains in SCOPe 2.08: d1e0ma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e0mA (A:)
  smglppgwdeykthngktyyynhntktstwtdprmss