PDB entry 1e0m

View 1e0m on RCSB PDB site
Description: PROTOTYPE WW domain
Class: de novo protein
Keywords: sh3 prototype, wwprototype, protein design, de novo protein
Deposited on 2000-04-01, released 2000-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: wwprototype
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E0M (0-36)
    Domains in SCOPe 2.07: d1e0ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0mA (A:)
    smglppgwdeykthngktyyynhntktstwtdprmss