PDB entry 1e0j

View 1e0j on RCSB PDB site
Description: gp4d helicase from phage T7 adpnp complex
Class: helicase
Keywords: helicase, ATPase, DNA replication
Deposited on 2000-03-30, released 2000-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.253
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA helicase
    Species: PHAGE T7 [TaxId:10760]
    Gene: GENE 4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0ja_
  • Chain 'B':
    Compound: DNA helicase
    Species: PHAGE T7 [TaxId:10760]
    Gene: GENE 4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0jb_
  • Chain 'C':
    Compound: DNA helicase
    Species: PHAGE T7 [TaxId:10760]
    Gene: GENE 4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0jc_
  • Chain 'D':
    Compound: DNA helicase
    Species: PHAGE T7 [TaxId:10760]
    Gene: GENE 4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0jd_
  • Chain 'E':
    Compound: DNA helicase
    Species: PHAGE T7 [TaxId:10760]
    Gene: GENE 4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0je_
  • Chain 'F':
    Compound: DNA helicase
    Species: PHAGE T7 [TaxId:10760]
    Gene: GENE 4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0jf_
  • Heterogens: ANP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0jA (A:)
    ipdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkst
    fvrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdq
    wfdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderk
    midnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtii
    alernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0jA (A:)
    ipdgvvsalslrerirehlsssvgllfsgctgindktlgarggevimvtsgsgmgkstfv
    rqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwf
    delfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkmi
    dnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiial
    ernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e0jB (B:)
    ipdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkst
    fvrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdq
    wfdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderk
    midnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtii
    alernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0jB (B:)
    pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf
    vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw
    fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm
    idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia
    lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e0jC (C:)
    ipdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkst
    fvrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdq
    wfdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderk
    midnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtii
    alernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0jC (C:)
    pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf
    vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw
    fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm
    idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia
    lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e0jD (D:)
    ipdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkst
    fvrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdq
    wfdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderk
    midnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtii
    alernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0jD (D:)
    ipdgvvsalslrerirehlsssvgllfsgctgindktlgarggevimvtsgsgmgkstfv
    rqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwf
    delfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkmi
    dnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiial
    ernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e0jE (E:)
    ipdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkst
    fvrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdq
    wfdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderk
    midnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtii
    alernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0jE (E:)
    pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf
    vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw
    fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm
    idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia
    lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e0jF (F:)
    ipdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkst
    fvrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdq
    wfdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderk
    midnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtii
    alernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0jF (F:)
    pdgvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstf
    vrqqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqw
    fdelfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkm
    idnlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiia
    lernqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg