PDB entry 1e0i

View 1e0i on RCSB PDB site
Description: concanavalin a, new crystal form
Class: lectin binding
Keywords: lectin binding
Deposited on 2000-03-29, released 2000-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-07-20, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.19
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81461 (0-236)
      • conflict (57)
      • conflict (69)
      • conflict (167)
      • conflict (191)
    Domains in SCOPe 2.07: d1e0ia_
  • Chain 'B':
    Compound: concanavalin a
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81461 (0-236)
      • conflict (57)
      • conflict (69)
      • conflict (167)
      • conflict (191)
    Domains in SCOPe 2.07: d1e0ib_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0iA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0iB (B:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan