PDB entry 1e0g

View 1e0g on RCSB PDB site
Description: LYSM Domain from E.coli MLTD
Class: hydrolase
Keywords: cell wall, hydrolase, glycosidase, lipoprotein, outer membrane, multigene family
Deposited on 2000-03-27, released 2000-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: membrane-bound lytic murein transglycosylase d
  Species: Escherichia coli, synthetic [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A2Z2J5F1 (0-47)
  Domains in SCOPe 2.08: d1e0ga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e0gA (A:)
  dsityrvrkgdslssiakrhgvnikdvmrwnsdtanlqpgdkltlfvk