PDB entry 1e0f

View 1e0f on RCSB PDB site
Description: Crystal structure of the human alpha-thrombin-haemadin complex: an exosite II-binding inhibitor
Class: hydrolase
Keywords: coagulation/crystal structure/heparin-b, coagulation/crystal structure/heparin-binding site/ hirudin/thrombin inhibitor, hydrolase
Deposited on 2000-03-27, released 2000-11-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.208
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e0f.1
  • Chain 'B':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e0f.2
  • Chain 'C':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e0f.3
  • Chain 'D':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-End)
      • conflict (45)
    Domains in SCOPe 2.06: d1e0f.1
  • Chain 'E':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-End)
      • conflict (45)
    Domains in SCOPe 2.06: d1e0f.2
  • Chain 'F':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • conflict (45)
    Domains in SCOPe 2.06: d1e0f.3
  • Chain 'I':
    Compound: haemadin
    Species: HAEMADIPSA SYLVESTRIS [TaxId:13555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e0fi_
  • Chain 'J':
    Compound: haemadin
    Species: HAEMADIPSA SYLVESTRIS [TaxId:13555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e0fj_
  • Chain 'K':
    Compound: haemadin
    Species: HAEMADIPSA SYLVESTRIS [TaxId:13555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e0fk_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0fA (A:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0fB (B:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e0fC (C:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0fC (C:)
    fgsgeadcglrplfekksledkterellesyidgr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e0fD (D:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknfiendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0fD (D:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknfiendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e0fE (E:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknfiendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0fE (E:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknfiendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0fF (F:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknfiendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0fI (I:)
    irfgmgkvpcpdgevgytcdcgekiclygqscndgqcsgdpkpssefeefeideeek
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1e0fJ (J:)
    irfgmgkvpcpdgevgytcdcgekiclygqscndgqcsgdpkpssefeefeideeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0fJ (J:)
    irfgmgkvpcpdgevgytcdcgekiclygqscndgqcsgdpkpssefeefeidee
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0fK (K:)
    irfgmgkvpcpdgevgytcdcgekiclygqscndgqcsgdpkpssefeefeideeek