PDB entry 1e0e

View 1e0e on RCSB PDB site
Description: N-terminal zinc-binding HHCC domain of HIV-2 integrase
Class: integrase
Keywords: integrase, aids, polyprotein, dimer, zinc-binding protein, helix-turn-helix motif
Deposited on 2000-03-25, released 2001-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human immunodeficiency virus type 2 integrase
    Species: HUMAN IMMUNODEFICIENCY VIRUS TYPE 2 (ISOLATE ROD) [TaxId:11720]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0ea_
  • Chain 'B':
    Compound: human immunodeficiency virus type 2 integrase
    Species: HUMAN IMMUNODEFICIENCY VIRUS TYPE 2 (ISOLATE ROD) [TaxId:11720]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0eb_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0eA (A:)
    flekiepaqeehekyhsnvkelshkfgipnlvarqivnscaqcqqkgeaihgqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0eA (A:)
    flekiepaqeehekyhsnvkelshkfgipnlvarqivnscaqcqqkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e0eB (B:)
    flekiepaqeehekyhsnvkelshkfgipnlvarqivnscaqcqqkgeaihgqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0eB (B:)
    flekiepaqeehekyhsnvkelshkfgipnlvarqivnscaqcqqkg