PDB entry 1e0d

View 1e0d on RCSB PDB site
Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
Class: ligase
Keywords: ligase, peptidoglycan synthesis, murd, ADP-forming enzyme
Deposited on 2000-03-24, released 2000-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylmuramoylalanine--d-glutamate ligase
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: MURD GENE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0da1, d1e0da2, d1e0da3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0dA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhln
    hqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglp
    hrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryln
    gdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfk
    nfeqrgnefarlakelg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0dA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edfglqqyraaklriyenakvcvvnaddaltmpiadercvsfgvnmgdyhlnhqqgetwl
    rvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglphrfevvle
    hngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplarylngdnvrlyc
    fgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfknfeqrgne
    farlakelg