PDB entry 1e0c

View 1e0c on RCSB PDB site
Description: sulfurtransferase from azotobacter vinelandii
Deposited on 2000-03-23, released 2000-05-08
The last revision prior to the SCOP 1.57 freeze date was dated 2000-08-18, with a file datestamp of 2000-08-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0cA (A:)
    mddfaslplviepadlqarlsapelilvdltsaaryaeghipgarfvdpkrtqlgqppap
    glqppreqleslfgelghrpeavyvvyddegggwagrfiwlldvigqqryhylnggltaw
    laedrplsrelpapaggpvalslhdeptasrdyllgrlgaadlaiwdarspqeyrgekvl
    aakgghipgavnfewtaamdpsralrirtdiagrleelgitpdkeivthcqthhrsglty
    liakalgyprvkgyagswgewgnhpdtpvel