PDB entry 1e0a

View 1e0a on RCSB PDB site
Description: Cdc42 complexed with the GTPase binding domain of p21 activated kinase
Class: signalling protein/kinase
Keywords: signalling protein, g protein signalling ser/thr kinase, signalling protein-kinase complex
Deposited on 2000-03-16, released 2000-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: g25k GTP-binding protein, placental isoform (gp), cdc42 homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25763 (0-183)
      • engineered mutation (60)
    Domains in SCOPe 2.06: d1e0aa_
  • Chain 'B':
    Compound: serine/threonine-protein kinase pak-alpha
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35465 (2-45)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d1e0ab1, d1e0ab2
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0aA (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0aB (B:)
    gsislpsdfehtihvgfdavtgeftgmpeqwarllqtsnitkseqk