PDB entry 1e0a
View 1e0a on RCSB PDB site
Description: cdc42 complexed with the gtpase binding domain of p21 activated kinase
Class: signalling protein
Keywords: signalling protein, g protein signalling ser/thr kinase
Deposited on
2000-03-16, released
2000-04-18
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: g25k GTP-binding protein, placental isoform (gp), cdc42 homolog
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1e0aa_ - Chain 'B':
Compound: serine/threonine-protein kinase pak-alpha
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1e0ab_ - Heterogens: GNP, MG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1e0aA (A:)
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1e0aB (B:)
gsislpsdfehtihvgfdavtgeftgmpeqwarllqtsnitkseqk