PDB entry 1e0a

View 1e0a on RCSB PDB site
Description: cdc42 complexed with the gtpase binding domain of p21 activated kinase
Class: signalling protein
Keywords: signalling protein, g protein signalling ser/thr kinase
Deposited on 2000-03-16, released 2000-04-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: g25k GTP-binding protein, placental isoform (gp), cdc42 homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25763 (0-183)
      • engineered mutation (60)
    Domains in SCOPe 2.02: d1e0aa_
  • Chain 'B':
    Compound: serine/threonine-protein kinase pak-alpha
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35465 (0-45)
      • cloning artefact (0-1)
    Domains in SCOPe 2.02: d1e0ab_
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0aA (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0aB (B:)
    gsislpsdfehtihvgfdavtgeftgmpeqwarllqtsnitkseqk