PDB entry 1e09

View 1e09 on RCSB PDB site
Description: solution structure of the major cherry allergen pru av 1
Class: allergen
Keywords: major cherry allergen, pathogenesis-related protein, heteronuclear nmr, structure
Deposited on 2000-03-15, released 2001-03-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-03, with a file datestamp of 2007-07-20.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pru av 1
    Species: Prunus avium
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e09a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e09A (A:)
gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilegdggpgtikkitfge
gsqygyvkhkidsidkenysysytliegdalgdtlekisyetklvaspsggsiikstshy
htkgnveikeehvkagkekasnlfklietylkghpdayn