PDB entry 1e07

View 1e07 on RCSB PDB site
Description: model of human carcinoembryonic antigen by homology modelling and curve-fitting to experimental solution scattering data
Deposited on 2000-03-11, released 2000-07-04
The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: SAXS
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carcinoembryonic antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1e07A (A:)
    kltiestpfnvaegkevlllvhnlpqhlfgyswykgervdgnrqiigyvigtqqatpgpa
    ysgreiiypnaslliqniiqndtgfytlhviksdlvneeatgqfrvypelpkpsissnns
    kpvedkdavaftcepetqdatylwwvnnqslpvsprlqlsngnrtltlfnvtrndtasyk
    cetqnpvsarrsdsvilnvlygpdaptisplntsyrsgenlnlschaasnppaqyswfvn
    gtfqqstqelfipnitvnnsgsytcqahnsdtglnrttvttitvyaeppkpfitsnnsnp
    vededavaltcepeiqnttylwwvnnqslpvsprlqlsndnrtltllsvtrndvgpyecg
    iqnelsvdhsdpvilnvlygpddptispsytyyrpgvnlslschaasnppaqyswlidgn
    iqqhtqelfisniteknsglytcqannsasghsrttvktitvsaelpkpsissnnskpve
    dkdavaftcepeaqnttylwwvngqslpvsprlqlsngnrtltlfnvtrndarayvcgiq
    nsvsanrsdpvtldvlygpdtpiisppdssylsganlnlschsasnpspqyswringipq
    qhtqvlfiakitpnnngtyacfvsnlatgrnnsivksitvsa