PDB entry 1e01

View 1e01 on RCSB PDB site
Description: lysm domain from e.coli mltd
Deposited on 2000-03-08, released 2000-06-21
The last revision was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: membrane-bound lytic murein transglycosylase d
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1e01A (A:)
    dsityrvrkgdslssiakrhgvnikdvmrwnsdtanlqpgdkltlfvk