PDB entry 1dzz

View 1dzz on RCSB PDB site
Description: l-fuculose-1-phosphate aldolase from escherichia coli mutant y113f
Deposited on 2000-03-07, released 2000-06-02
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-20, with a file datestamp of 2000-07-20.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.159
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Domains in SCOP 1.55: d1dzzp_

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dzzP (P:)
    mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
    ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihfmiaaagg
    nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
    ylttlaitdpvpvlsdeeiavvlekfkt