PDB entry 1dzv

View 1dzv on RCSB PDB site
Description: l-fuculose-1-phosphate aldolase from escherichia coli mutant y113f/y209f
Deposited on 2000-03-07, released 2000-06-02
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-20, with a file datestamp of 2000-07-20.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Domains in SCOP 1.55: d1dzvp_

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dzvP (P:)
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihfmiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekf