PDB entry 1dzv

View 1dzv on RCSB PDB site
Description: L-Fuculose-1-Phosphate Aldolase from Escherichia coli Mutant Y113F/Y209F
Class: lyase (aldehyde)
Keywords: lyase (aldehyde), aldolase (class II), bacterial l-fucose metabolism, cleavage of l-fuculose-1-phosphate to dihydroxyacetonephosphate and l-lactaldehyde, mutant structure
Deposited on 2000-03-07, released 2000-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: l-fuculose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11550 (0-End)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d1dzvp_
  • Heterogens: SO4, BME, ZN, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1dzvP (P:)
    mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
    ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihfmiaaagg
    nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
    ylttlaitdpvpvlsdeeiavvlekfktfglriee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzvP (P:)
    mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
    ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihfmiaaagg
    nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
    ylttlaitdpvpvlsdeeiavvlekf