PDB entry 1dzs

View 1dzs on RCSB PDB site
Description: ms2-RNA hairpin (4one-5) complex
Class: virus/viral protein/RNA
Keywords: hairpin, capsid, levivirus
Deposited on 2000-03-07, released 2000-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.2
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (capsid protein ms2)
    Species: BACTERIOPHAGE MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dzsa_
  • Chain 'B':
    Compound: protein (capsid protein ms2)
    Species: BACTERIOPHAGE MS2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: protein (capsid protein ms2)
    Species: BACTERIOPHAGE MS2
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: RNA (5'-r(*ap*c*ap*up*gp*ap*gp*gp*ap*up*(one)p*ap*cp*cp*cp*ap*up*gp*u)-3')
  • Chain 'S':
    Compound: RNA (5'-r(*ap*c*ap*up*gp*ap*gp*gp*ap*up*(one)p*ap*cp*cp*cp*ap*up*gp*u)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dzsA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.