PDB entry 1dzq

View 1dzq on RCSB PDB site
Description: lectin uea-II complexed with galactose
Class: lectin
Keywords: lectin, carbohydrate binding, galactose
Deposited on 2000-03-07, released 2000-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.186
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ulex europaeus lectin II (uea-II)
    Species: Ulex europeus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FVF8
      • onflict (24)
      • onflict (61)
      • onflict (105)
      • onflict (111)
      • onflict (190)
      • onflict (228)
    Domains in SCOP 1.73: d1dzqa_
  • Chain 'B':
    Compound: ulex europaeus lectin II (uea-II)
    Species: Ulex europeus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FVF8
      • onflict (24)
      • onflict (61)
      • onflict (105)
      • onflict (111)
      • onflict (190)
      • onflict (228)
    Domains in SCOP 1.73: d1dzqb_
  • Chain 'C':
    Compound: ulex europaeus lectin II (uea-II)
    Species: Ulex europeus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FVF8
      • onflict (24)
      • onflict (61)
      • onflict (105)
      • onflict (111)
      • onflict (190)
      • onflict (228)
    Domains in SCOP 1.73: d1dzqc_
  • Chain 'D':
    Compound: ulex europaeus lectin II (uea-II)
    Species: Ulex europeus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FVF8
      • onflict (24)
      • onflict (61)
      • onflict (105)
      • onflict (111)
      • onflict (190)
      • onflict (228)
    Domains in SCOP 1.73: d1dzqd_
  • Heterogens: NAG, GAL, MN, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzqA (A:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzqA (A:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvstttsigralyaapiqiwdsitg
    kvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqiia
    vefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptksltvc
    lsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dzqB (B:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzqB (B:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dzqC (C:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzqC (C:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dzqD (D:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzqD (D:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle