PDB entry 1dzq

View 1dzq on RCSB PDB site
Description: lectin uea-ii complexed with galactose
Deposited on 2000-03-07, released 2000-06-22
The last revision prior to the SCOP 1.67 freeze date was dated 2000-09-02, with a file datestamp of 2000-09-02.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.186
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1dzqa_
  • Chain 'B':
    Domains in SCOP 1.67: d1dzqb_
  • Chain 'C':
    Domains in SCOP 1.67: d1dzqc_
  • Chain 'D':
    Domains in SCOP 1.67: d1dzqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzqA (A:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzqA (A:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvstttsigralyaapiqiwdsitg
    kvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqiia
    vefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptksltvc
    lsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dzqB (B:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzqB (B:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dzqC (C:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzqC (C:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dzqD (D:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzqD (D:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle