PDB entry 1dzp

View 1dzp on RCSB PDB site
Description: Porcine Odorant Binding Protein Complexed with diphenylmethanone
Class: transport protein
Keywords: odorant binding protein, lipocalins, transport protein
Deposited on 2000-03-06, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant-binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dzpa_
  • Chain 'B':
    Compound: odorant-binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dzpb_
  • Heterogens: BZQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzpA (A:)
    qepqpeqdpfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffsken
    giceefsligtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgk
    gtdiedqdlekfkevtrengipeenivniierddcpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzpA (A:)
    pfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsl
    igtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqd
    lekfkevtrengipeenivniierddcpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dzpB (B:)
    qepqpeqdpfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffsken
    giceefsligtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgk
    gtdiedqdlekfkevtrengipeenivniierddcpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzpB (B:)
    elsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefslig
    tkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdle
    kfkevtrengipeenivniierddcpa