PDB entry 1dzo

View 1dzo on RCSB PDB site
Description: truncated pak pilin from pseudomonas aeruginosa
Class: type IV pilin
Keywords: type IV pilin, lectin, adhesin
Deposited on 2000-03-06, released 2000-06-11
The last revision prior to the SCOP 1.73 freeze date was dated 2000-06-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.153
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type IV pilin
    Species: Pseudomonas aeruginosa
    Gene: PILA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dzoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1dzoA (A:)
alegtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadank
lgtialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkg
csr

    Sequence, based on observed residues (ATOM records): (download) 
    >1dzoA (A:)
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr