PDB entry 1dzo

View 1dzo on RCSB PDB site
Description: Truncated PAK pilin from Pseudomonas aeruginosa
Class: cell adhesion
Keywords: lectin, adhesin, cell adhesion
Deposited on 2000-03-06, released 2000-06-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type IV pilin
    Species: PSEUDOMONAS AERUGINOSA PAK [TaxId:1009714]
    Gene: PILA
    Database cross-references and differences (RAF-indexed):
    • PDB 1DZO (Start-6)
    • Uniprot P02973 (7-122)
    Domains in SCOPe 2.08: d1dzoa1, d1dzoa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzoA (A:)
    alegtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadank
    lgtialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkg
    csr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzoA (A:)
    gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
    ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr