PDB entry 1dzn

View 1dzn on RCSB PDB site
Description: asp170ser mutant of vanillyl-alcohol oxidase
Deposited on 2000-03-05, released 2000-03-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-21, with a file datestamp of 2000-07-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22686
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dznA (A:)
    afrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpslgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dznA (A:)
    afrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdphhvmdqdyfl
    asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
    levnvegaycvvepgvtyhdlhnyleannlrdklwldvpslgggsvlgnavergvgytpy
    gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
    dglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmalqnvpt
    irhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwet
    ikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffspiak
    vsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrt
    liddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwp
    sqyshvtwkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dznB (B:)
    afrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpslgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dznB (B:)
    afrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdphhvmdqdyfl
    asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
    levnvegaycvvepgvtyhdlhnyleannlrdklwldvpslgggsvlgnavergvgytpy
    gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
    dglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmalqnvpt
    irhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwet
    ikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffspiak
    vsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrt
    liddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwp
    sqyshvtwkl