PDB entry 1dzi

View 1dzi on RCSB PDB site
Description: integrin alpha2 I domain / collagen complex
Class: integrin
Keywords: integrin, collagen
Deposited on 2000-03-01, released 2001-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: integrin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17301 (0-184)
    • conflict (0)
  Domains in SCOPe 2.08: d1dzia_
• Chain 'B':
  Compound: collagen
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 1DZI (0-End)
  Domains in SCOPe 2.08: d1dzib1, d1dzib2
• Chain 'C':
  Compound: collagen
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 1DZI (0-End)
  Domains in SCOPe 2.08: d1dzic1, d1dzic2
• Chain 'D':
  Compound: collagen
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 1DZI (0-End)
  Domains in SCOPe 2.08: d1dzid1, d1dzid2
• Heterogens: CO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dziA (A:)
  alidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyk
  tkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgs
  mlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaal
  lekag
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dziB (B:)
  gppgppgfpgergppgppgpp
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dziC (C:)
  gppgppgfpgergppgppgpp
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dziD (D:)
  gppgppgfpgergppgppgpp