PDB entry 1dzf

View 1dzf on RCSB PDB site
Description: RPB5 from S.cerevisiae
Deposited on 2000-02-25, released 2000-06-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-09, with a file datestamp of 2000-06-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dzfA (A:)
    nernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqanp
    teesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamklv
    psippatietfneaalvvnithhelvpkhirlssdekrellkryrlkesqlpriqradpv
    alylglkrgevvkiirksetsgryasyricm