PDB entry 1dzf

View 1dzf on RCSB PDB site
Description: RPB5 from S.cerevisiae
Class: transferase
Keywords: RNA polymerase, RNA polymerase subunit, transferase
Deposited on 2000-02-25, released 2000-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 1
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:559292]
    Gene: YBR154C OR YBR1204
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dzfa1, d1dzfa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzfA (A:)
    mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
    qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
    mklvpsippatietfneaalvvnithhelvpkhirlssdekrellkryrlkesqlpriqr
    adpvalylglkrgevvkiirksetsgryasyricm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzfA (A:)
    nernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqanp
    teesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamklv
    psippatietfneaalvvnithhelvpkhirlssdekrellkryrlkesqlpriqradpv
    alylglkrgevvkiirksetsgryasyricm