PDB entry 1dze

View 1dze on RCSB PDB site
Description: structure of the m intermediate of bacteriorhodopsin trapped at 100k
Class: bacteriorhodopsin
Keywords: bacteriorhodopsin, proton pump, membrane protein, retinal protein, photoreceptor, reaction intermediate, halobacteria, ion pump, helix, sliding
Deposited on 2000-02-25, released 2000-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.257
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin (m intermediate)
    Species: HALOBACTERIUM SALINARIUM [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dzea_
  • Heterogens: RET, L1P, L2P, L3P, L4P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzeA (A:)
    qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzeA (A:)
    grpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgyg
    ltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvg
    altkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsay
    pvvwligsegagivplnietllfmvldvsakvgfglillrsraif