PDB entry 1dzd

View 1dzd on RCSB PDB site
Description: high resolution structure of acidic fibroblast growth factor (27-154), 24 nmr structures
Class: growth factor
Keywords: growth factor, fibroblast growth factor, antitumoral
Deposited on 2000-02-24, released 2000-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dzda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dzdA (A:)
    lycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtdgll
    ygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkailfl
    plpvssd