PDB entry 1dzc

View 1dzc on RCSB PDB site
Description: high resolution structure of acidic fibroblast growth factor. mutant fgf-4-ala-(23-154), 24 nmr structures
Class: growth factor
Keywords: growth factor, fibroblast growth factor, antitumoral
Deposited on 2000-02-24, released 2000-03-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: acidic fibroblast growth factor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05230 (0-130)
    • engineered mutation (0-2)
  Domains in SCOPe 2.01: d1dzca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dzcA (A:)
  aaallycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
  dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
  ilflplpvssd