PDB entry 1dzc

View 1dzc on RCSB PDB site
Description: High resolution structure of acidic fibroblast growth factor. Mutant FGF-4-ALA-(24-154), 24 NMR structures
Class: cell cycle
Keywords: growth factor, cell cycle, antitumoral
Deposited on 2000-02-24, released 2000-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fibroblast growth factor 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05230 (0-130)
    • engineered mutation (0-2)
  Domains in SCOPe 2.08: d1dzca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dzcA (A:)
  aaallycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
  dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
  ilflplpvssd