PDB entry 1dzb

View 1dzb on RCSB PDB site
Description: crystal structure of phage library-derived single-chain fv fragment 1f9 in complex with turkey egg-white lysozyme
Class: immune system
Keywords: immune system, complex (antibody antigen), single-domain antibody, turkey egg-white lysozyme, antibody- protein complex, single-chain fv fragment
Deposited on 2000-02-23, released 2000-11-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: scfv fragment 1f9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • TREMBL CAA05093 (0-115)
    • PDB 1DZB
    • TREMBL CAA05094 (131-237)
    Domains in SCOPe 2.03: d1dzba1, d1dzba2
  • Chain 'B':
    Compound: scfv fragment 1f9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • TREMBL CAA05093 (0-115)
    • PDB 1DZB
    • TREMBL CAA05094 (131-237)
    Domains in SCOPe 2.03: d1dzbb1, d1dzbb2
  • Chain 'X':
    Compound: turkey egg-white lysozyme c
    Species: MELEAGRIS GALLOPAVO [TaxId:9103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dzbx_
  • Chain 'Y':
    Compound: turkey egg-white lysozyme c
    Species: MELEAGRIS GALLOPAVO [TaxId:9103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dzby_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzbA (A:)
    qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
    dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssgggg
    sggggsggggsdieltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliy
    yatsladgvpsrfsgsgsgqdysltisslesddtttyyclqhgespytfgggtkleikra
    aaeqkliseedln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzbA (A:)
    qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
    dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssgdie
    ltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliyyatsladgvpsrfs
    gsgsgqdysltisslesddtttyyclqhgespytfgggtkleik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dzbB (B:)
    qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
    dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssgggg
    sggggsggggsdieltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliy
    yatsladgvpsrfsgsgsgqdysltisslesddtttyyclqhgespytfgggtkleikra
    aaeqkliseedln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzbB (B:)
    qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
    dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssgdie
    ltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliyyatsladgvpsrfs
    gsgsgqdysltisslesddtttyyclqhgespytfgggtkleik
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dzbX (X:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dzbY (Y:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl