PDB entry 1dzb

View 1dzb on RCSB PDB site
Description:
Deposited on 2000-02-23, released 2000-11-02
The last revision prior to the SCOP 1.63 freeze date was dated 2000-11-02, with a file datestamp of 2000-11-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1dzba1, d1dzba2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1dzbb1, d1dzbb2
  • Chain 'X':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1dzbx_
  • Chain 'Y':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1dzby_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzbA (A:)
    qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
    dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssgggg
    sggggsggggsdieltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliy
    yatsladgvpsrfsgsgsgqdysltisslesddtttyyclqhgespytfgggtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzbA (A:)
    qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
    dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssgdie
    ltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliyyatsladgvpsrfs
    gsgsgqdysltisslesddtttyyclqhgespytfgggtkleik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dzbB (B:)
    qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
    dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssgggg
    sggggsggggsdieltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliy
    yatsladgvpsrfsgsgsgqdysltisslesddtttyyclqhgespytfgggtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzbB (B:)
    qvklqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
    dpkfqgkatitadtssntaylqlssltsedtavyycarwdwyfdvwgqgttvtvssgdie
    ltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliyyatsladgvpsrfs
    gsgsgqdysltisslesddtttyyclqhgespytfgggtkleik
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dzbX (X:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dzbY (Y:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl