PDB entry 1dza

View 1dza on RCSB PDB site
Description: 3-d structure of a hp-rnase
Deposited on 2000-02-21, released 2001-02-16
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-16, with a file datestamp of 2001-02-16.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.177
AEROSPACI score: -1.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1dzaa_
  • Chain 'B':
    Domains in SCOP 1.59: d1dzab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzaA (A:)
    mkesaaakferqhmdsgnspsssstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcf
    qekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvh
    fdasve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzaA (A:)
    mkesaaakferqhmdsgnstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqekvt
    ckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasv
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dzaB (B:)
    esaaakferqhmdsgnspsssstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqe
    kvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfd
    asved
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzaB (B:)
    esaaakferqhmdsgnsstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqekvtc
    kngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasve
    d