PDB entry 1dz7

View 1dz7 on RCSB PDB site
Description: Solution structure of the a-subunit of human chorionic gonadotropin [modeled without carbohydrate residues]
Class: glycoprotein
Keywords: glycoprotein, chorionic gonadotropin, chorionic gonadotropin free a subunit, glycoprotein structure, cystine knot, xplor
Deposited on 2000-02-18, released 2000-02-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorionic gonadotropin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dz7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dz7A (A:)
    apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
    vaksynrvtvmggfkvenhtachcstcyyhks