PDB entry 1dz5
View 1dz5 on RCSB PDB site
Description: The NMR structure of the 38KDa U1A protein-PIE RNA complex reveals the basis of cooperativity in regulation of polyadenylation by human U1A protein
Class: ribonucleoprotein/RNA
Keywords: ribonucleoprotein-RNA complex, polyadenylation, protein protein interaction, RNA protein interaction
Deposited on
2000-02-16, released
2000-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2013-05-15, with a file datestamp of
2013-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: U1 small nuclear ribonucleoprotein A
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P09012 (0-100)
- engineered mutation (29)
- engineered mutation (34)
Domains in SCOPe 2.08: d1dz5a_ - Chain 'B':
Compound: U1 small nuclear ribonucleoprotein A
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P09012 (0-100)
- engineered mutation (29)
- engineered mutation (34)
Domains in SCOPe 2.08: d1dz5b_ - Chain 'C':
Compound: pie, RNA (5'-r(*gp*ap*gp*ap*cp*ap*up*up*gp*cp*ap*cp*cp* cp*gp*gp*ap*gp*up*cp*up*c)-3')
Species: HOMO SAPIENS, synthetic [TaxId:9606]
- Chain 'D':
Compound: pie, RNA (5'-r(*gp*ap*gp*ap*cp*ap*up*up*gp*cp*ap*cp*cp* cp*gp*gp*ap*gp*up*cp*up*c)-3')
Species: HOMO SAPIENS, synthetic [TaxId:9606]
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1dz5A (A:)
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1dz5B (B:)
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.