PDB entry 1dz3

View 1dz3 on RCSB PDB site
Description: domain-swapping in the sporulation response regulator spo0a
Class: response regulator
Keywords: response regulator, domain swapping
Deposited on 2000-02-15, released 2000-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.23538
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stage 0 sporulation protein a
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Gene: SPO0A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dz3a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dz3A (A:)
    msikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimph
    ldglavleriragfehqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqv
    ygkttpvvrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dz3A (A:)
    sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl
    dglavleriragfehqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvy
    gkt