PDB entry 1dz1

View 1dz1 on RCSB PDB site
Description: mouse hp1 (m31) c terminal (shadow chromo) domain
Class: chromatin structure
Keywords: chromatin structure, chromo domain, heterochromatin protein protein interaction, homodimer
Deposited on 2000-02-11, released 2000-04-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: modifier 1 protein
  Species: Mus musculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83917 (2-69)
  Domains in SCOP 1.75: d1dz1a_
• Chain 'B':
  Compound: modifier 1 protein
  Species: Mus musculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83917 (2-69)
  Domains in SCOP 1.75: d1dz1b_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dz1A (A:)
  hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
  sfyeerltwh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dz1B (B:)
  hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
  sfyeerltwh