PDB entry 1dz1

View 1dz1 on RCSB PDB site
Description: mouse hp1 (m31) c terminal (shadow chromo) domain
Deposited on 2000-02-11, released 2000-04-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dz1a_
  • Chain 'B':
    Domains in SCOP 1.55: d1dz1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dz1A (A:)
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dz1B (B:)
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwh