PDB entry 1dz1

View 1dz1 on RCSB PDB site
Description: Mouse HP1 (M31) C terminal (shadow chromo) domain
Class: chromatin structure
Keywords: chromatin structure, chromo domain, heterochromatin protein protein interaction, dimeric
Deposited on 2000-02-11, released 2000-04-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modifier 1 protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DZ1 (0-1)
    • Uniprot P83917 (2-69)
    Domains in SCOPe 2.08: d1dz1a1, d1dz1a2
  • Chain 'B':
    Compound: modifier 1 protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DZ1 (0-1)
    • Uniprot P83917 (2-69)
    Domains in SCOPe 2.08: d1dz1b1, d1dz1b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dz1A (A:)
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dz1B (B:)
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwh