PDB entry 1dz0

View 1dz0 on RCSB PDB site
Description: reduced azurin ii from alcaligenes xylosoxidans
Deposited on 2000-02-11, released 2000-07-04
The last revision prior to the SCOP 1.57 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1dz0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dz0A (A:)
    aqceatvesndamqynvkeivvdksckqftmhlkhvgkmakvamghnlvltkdadkqava
    tdgmgaglaqdyvkagdtrviahtkvigggesdsvtfdvskiaagenyayfcsfpghwam
    mkgtlklgs