PDB entry 1dz0

View 1dz0 on RCSB PDB site
Description: reduced azurin II from alcaligenes xylosoxidans
Class: electron transport
Keywords: electron transport, cupredoxin, cuproprotein
Deposited on 2000-02-11, released 2000-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: azurin II
    Species: ALCALIGENES XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dz0a_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dz0A (A:)
    aqceatvesndamqynvkeivvdksckqftmhlkhvgkmakvamghnlvltkdadkqava
    tdgmgaglaqdyvkagdtrviahtkvigggesdsvtfdvskiaagenyayfcsfpghwam
    mkgtlklgs