PDB entry 1dyz

View 1dyz on RCSB PDB site
Description: oxidised azurin ii from alcaligenes xylosoxidans
Deposited on 2000-02-11, released 2000-07-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-21, with a file datestamp of 2000-07-21.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dyza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dyzA (A:)
    aqceatvesndamqynvkeivvdksckqftmhlkhvgkmakvamghnlvltkdadkqava
    tdgmgaglaqdyvkagdtrviahtkvigggesdsvtfdvskiaagenyayfcsfpghwam
    mkgtlklgs