PDB entry 1dyv

View 1dyv on RCSB PDB site
Description: crystal structure of circularly permuted cpdsba_q100t99
Deposited on 2000-02-09, released 2000-02-11
The last revision was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.232
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiol-disulfide interchange protein
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991 (71-193)
      • conflict (72-78)
      • conflict (80-81)
      • conflict (83-85)
      • insertion (87)
      • insertion (83-86)
      • conflict (87)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1dyvA (A:)
    qtirsasdirdvfinagikgeeydaawnsfvvkslvaqqekaaadvqlrgvpamfvngky
    qlnpqgmdtsnmdvfvqqyadtvkylsekkgggtgaqyedgkqyttlekpvagapqvlef
    fsffcphcyqfeevlhisdnvkkklpegvkmtkyhvnfmggdlgkdltqawavamalgve
    dkvtvplfegvqktlik
    

    Sequence, based on observed residues (ATOM records):
    >1dyvA (A:)
    qtirsasdirdvfinagikgeeydaawnsfvvkslvaqqekaaadvqlrgvpamfvngky
    qlnpqgmdtsnmdvfvqqyadtvkylseyedgkqyttlekpvagapqvleffsffcphcy
    qfeevlhisdnvkkklpegvkmtkyhvnfmggdlgkdltqawavamalgvedkvtvplfe
    gvqktl