PDB entry 1dyt

View 1dyt on RCSB PDB site
Description: x-ray crystal structure of ecp (rnase 3) at 1.75 a
Deposited on 2000-02-08, released 2001-02-08
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-08, with a file datestamp of 2001-02-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.224
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1dyta_
  • Chain 'B':
    Domains in SCOP 1.59: d1dytb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dytA (A:)
    rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
    rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
    rypvvpvhldtti
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dytB (B:)
    rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
    rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
    rypvvpvhldtti