PDB entry 1dyt

View 1dyt on RCSB PDB site
Description: x-ray crystal structure of ecp (RNAse 3) at 1.75 a
Class: hydrolase
Keywords: hydrolase, eosinophil cationic protein, ecp, RNAse 3
Deposited on 2000-02-08, released 2001-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.224
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eosinophil cationic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RNASE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dyta_
  • Chain 'B':
    Compound: eosinophil cationic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RNASE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dytb_
  • Heterogens: FE, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dytA (A:)
rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
rypvvpvhldtti

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dytB (B:)
rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
rypvvpvhldtti