PDB entry 1dys

View 1dys on RCSB PDB site
Description: endoglucanase cel6b from humicola insolens
Class: cellulase
Keywords: cellulase, hydrolase, cellulose degradation, glycoside hydrolase family 6
Deposited on 2000-02-08, released 2001-02-08
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Humicola insolens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dysa_
  • Chain 'B':
    Compound: endoglucanase
    Species: Humicola insolens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dysb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dysA (A:)
    qsgnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllr
    didvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpf
    aqklkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyld
    vanggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgsps
    pdesryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnn
    pnvdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dysA (A:)
    gnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllrdi
    dvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpfaq
    klkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyldva
    nggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgspspd
    esryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnnpn
    vdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dysB (B:)
    qsgnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllr
    didvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpf
    aqklkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyld
    vanggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgsps
    pdesryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnn
    pnvdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dysB (B:)
    gnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllrdi
    dvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpfaq
    klkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyldva
    nggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgspspd
    esryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnnpn
    vdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeia