PDB entry 1dys

View 1dys on RCSB PDB site
Description: endoglucanase cel6b from humicola insolens
Deposited on 2000-02-08, released 2001-02-08
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-08, with a file datestamp of 2001-02-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dysa_
  • Chain 'B':
    Domains in SCOP 1.55: d1dysb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dysA (A:)
    gnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllrdi
    dvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpfaq
    klkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyldva
    nggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgspspd
    esryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnnpn
    vdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeia
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dysB (B:)
    gnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllrdi
    dvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpfaq
    klkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyldva
    nggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgspspd
    esryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnnpn
    vdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeia