PDB entry 1dys

View 1dys on RCSB PDB site
Description: Endoglucanase CEL6B from Humicola insolens
Class: cellulase
Keywords: cellulase, hydrolase, cellulose degradation, glycoside hydrolase family 6
Deposited on 2000-02-08, released 2001-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Humicola insolens [TaxId:34413]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DYS
    Domains in SCOPe 2.07: d1dysa_
  • Chain 'B':
    Compound: endoglucanase
    Species: Humicola insolens [TaxId:34413]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DYS
    Domains in SCOPe 2.07: d1dysb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dysA (A:)
    qsgnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllr
    didvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpf
    aqklkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyld
    vanggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgsps
    pdesryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnn
    pnvdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dysA (A:)
    gnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllrdi
    dvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpfaq
    klkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyldva
    nggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgspspd
    esryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnnpn
    vdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dysB (B:)
    qsgnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllr
    didvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpf
    aqklkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyld
    vanggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgsps
    pdesryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnn
    pnvdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dysB (B:)
    gnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllrdi
    dvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpfaq
    klkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyldva
    nggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgspspd
    esryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnnpn
    vdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeia