PDB entry 1dyq

View 1dyq on RCSB PDB site
Description: staphylococcal enterotoxin a mutant vaccine
Class: enterotoxin
Keywords: enterotoxin, staphylococcal enterotoxin type a, vaccine
Deposited on 2000-02-05, released 2001-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: -1.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal enterotoxin a mutant
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DYQ
      • engineered (48)
      • engineered (70)
      • engineered (92)
    • Uniprot P13163 (Start-233)
    Domains in SCOPe 2.07: d1dyqa1, d1dyqa2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dyqA (A:)
    msekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqfrqhtilfkgfft
    dhswyndllvrfdskdivdkykgkkvdlygayagyqcaggtpnktacmyggvtlhdnnrl
    teekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkv
    qrglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dyqA (A:)
    einekdlrkkselqgtalgnlkqiyyynekaktenkeshdqfrqhtilfkgfftdhswyn
    dllvrfdskdivdkykgkkvdlygayagyqcaggtpnktacmyggvtlhdnnrlteekkv
    pinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrgliv
    fhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts